Load FASTA¶
Loads a FASTA-formatted sequence string into the workflow. It is a simple pass-through loader that accepts any provided text and outputs it as a FASTA-type value without validation or transformation.
Usage¶
Use this node when you want to manually input or paste a protein (or nucleotide) FASTA sequence to start or feed a biotech workflow. Typical use: paste one or more FASTA records here, then connect the output to nodes that consume FASTA (e.g., sequence processing, structure design/fixing, or combiner nodes).
Inputs¶
| Field | Required | Type | Description | Example |
|---|---|---|---|---|
| fasta_string | True | STRING | FASTA sequence string to upload. Can contain one or more records. The content is not validated or reformatted by this node. | >seq1 MKTFFVLVLLLALATASA >seq2 GASVVVSDIVKDLGAT |
Outputs¶
| Field | Type | Description | Example |
|---|---|---|---|
| sequence.fasta | FASTA | The provided FASTA string, passed through unchanged. | >my_protein MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDW |
Important Notes¶
- Pass-through behavior: The node returns the input exactly as provided; it does not validate FASTA syntax, parse headers, or standardize line lengths.
- Multiple records allowed: You can include multiple FASTA entries. Downstream nodes must support multi-record FASTA if you provide more than one sequence.
- No metadata attached: Unlike some other loaders, the output is a plain FASTA string without additional metadata or IDs added by this node.
- Formatting expectations: For best compatibility, include standard FASTA headers (lines beginning with '>') and use amino-acid or nucleotide letters as appropriate for downstream tools.
Troubleshooting¶
- Downstream node errors: If a connected node fails to parse the input, ensure the FASTA is valid (each record starts with a header line beginning with '>' followed by sequence lines).
- Unexpected output content: This node does not modify input; verify there are no hidden characters or unsupported symbols in the pasted text.
- Multiple sequence handling: If a downstream node expects a single sequence but you provided multiple records, split your input or use a combiner/splitter node appropriately.
- Line wrapping issues: Some tools expect wrapped lines (e.g., 60–80 chars). If required, manually wrap the sequence before loading.