Load FASTA¶
Loads a FASTA sequence string into the workflow. It accepts user-provided FASTA text and passes it through unchanged for downstream processing.
Usage¶
Use this node at the start of a biotech workflow when you need to provide one or more protein/DNA/RNA sequences in FASTA format. Connect its output to any node that expects FASTA input.
Inputs¶
| Field | Required | Type | Description | Example |
|---|---|---|---|---|
| fasta_string | True | STRING | Raw FASTA content to load. Supports multiline text and can contain one or multiple FASTA records. | >seq1 MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ >seq2 GASMVENLYFQG |
Outputs¶
| Field | Type | Description | Example |
|---|---|---|---|
| sequence.fasta | FASTA | The FASTA content provided as input, unchanged. | >my_protein ACDEFGHIKLMNPQRSTVWY |
Important Notes¶
- Pass-through behavior: The node does not validate or modify the FASTA; it returns exactly what you provide.
- Multiple records: You can include multiple sequences; ensure each record starts with a header line beginning with '>'.
- Formatting: Maintain standard FASTA formatting (header line, newline-separated sequence lines). Extraneous spaces or invalid characters may cause downstream nodes to fail.
Troubleshooting¶
- Downstream errors parsing FASTA: Ensure each sequence has a header starting with '>' and sequence lines contain only valid characters for your modality (e.g., A–Z for proteins).
- Unexpected empty output: Verify the input field is not blank and contains visible characters (no only whitespace).
- Multiple sequences not recognized: Confirm records are separated by newlines and each has its own header line.